DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and GPAT4

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001350126.1 Gene:GPAT4 / 137964 HGNCID:20880 Length:456 Species:Homo sapiens


Alignment Length:213 Identity:50/213 - (23%)
Similarity:85/213 - (39%) Gaps:60/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IFFGAGLIVFLC--VPFMIL----------------------RPRDYRNALFPSWCFRQLCRLVG 73
            :.:|.|:::..|  :|..|.                      |.:::.:......|:|...|.:.
Human   162 VLWGLGVLIRYCFLLPLRIALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALT 226

  Fly    74 ITMEVRGLENVRKDHGAVVIMNHQSAVDLCVLAY-------------LWPVIGRATVVSKKEVLY 125
            ..:.....|| |..:|.:.:.||.|.:|:.:||.             |..||.||.|.:...|  
Human   227 AIITYHDREN-RPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHV-- 288

  Fly   126 IPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERN-CKLLLFPEGTRNSKDSLLPFKKGSF 189
                          :.:||...|.....::..:.:|::: ..:|:|||||..:..|::.||||||
Human   289 --------------WFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSF 339

  Fly   190 HIALQGKSPVQPVVISKY 207
            .|.    :.|.||.| ||
Human   340 EIG----ATVYPVAI-KY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 43/157 (27%)
GPAT4NP_001350126.1 LPLAT_LPCAT1-like 218..427 CDD:153253 43/157 (27%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 248..253 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.