DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and AGPAT1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001358366.1 Gene:AGPAT1 / 10554 HGNCID:324 Length:287 Species:Homo sapiens


Alignment Length:244 Identity:82/244 - (33%)
Similarity:135/244 - (55%) Gaps:6/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APYQMRMFFIFFGAGLIVFLCV---PFMILRPRDYRNALFPSWCFRQLCRLVGITMEVRGLENVR 85
            :|.....|.:.|..|.|:||.|   |...:|.|:..|..........:..|.||.:||||..:..
Human    33 SPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFP 97

  Fly    86 KDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYIDRSRKTDSI 150
            .....||:.||||::||..:..:.|  ||...::|:|:|:....|:..||.|.::|||.|..|:|
Human    98 PSQPYVVVSNHQSSLDLLGMMEVLP--GRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAI 160

  Fly   151 NSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVISKY-SFMDDEK 214
            :.:.:.|:.:..::.::.:|||||||...|:||||:|:||:|:|.:.|:.|:|:|.| .|...::
Human   161 SVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKE 225

  Fly   215 KTFRPGHALIHILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSKEGQ 263
            :.|..|...:.:||.|.||....:||..|.|..:..|.|.:.::|.:|:
Human   226 RRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 66/183 (36%)
AGPAT1NP_001358366.1 LPLAT_AGPAT-like 73..259 CDD:153251 66/187 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623097at2759
OrthoFinder 1 1.000 - - FOG0001236
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100535
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.