DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and Gpat4

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011240406.1 Gene:Gpat4 / 102247 MGIID:2142716 Length:462 Species:Mus musculus


Alignment Length:194 Identity:49/194 - (25%)
Similarity:82/194 - (42%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MRMFFIFFGAGLIVFLCVPFMIL---RPRDYRNALFPSWCFRQLCRLVGITMEVRGLENVRKDHG 89
            :|:...|.|.||:|........|   |.:::.:......|:|...|.:...:.....:| |..:|
Mouse   178 LRIALAFTGIGLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHNRKN-RPRNG 241

  Fly    90 AVVIMNHQSAVDLCVLAY-------------LWPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYI 141
            .:.:.||.|.:|:.:||.             |..||.||.|.:...|                :.
Mouse   242 GICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHV----------------WF 290

  Fly   142 DRSRKTDSINSLQKEAKAIQERN-CKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVI 204
            :||...|.....::..:.:|::: ..:|:|||||..:..|::.||||||.|.    :.|.||.|
Mouse   291 ERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIG----ATVYPVAI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 40/154 (26%)
Gpat4XP_011240406.1 LPLAT_LPCAT1-like 218..433 CDD:153253 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.