DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and lpgat1

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_017949604.1 Gene:lpgat1 / 100494107 XenbaseID:XB-GENE-985546 Length:429 Species:Xenopus tropicalis


Alignment Length:275 Identity:69/275 - (25%)
Similarity:115/275 - (41%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VALILSATAKAPYQ-MRMFFIFFGAGLIV--FLCVPFMILRPRDYRNALFP--------SW---- 63
            :|:...:|.:..:. :||...|  |.::|  .:.:|..:|    |..||.|        .|    
 Frog    60 MAITADSTGRMGFLILRMVLRF--AFMVVNNMVAIPSYVL----YLIALQPVRVIDRKLFWYIEG 118

  Fly    64 -CFRQLCRLV-------GITMEVRGLENVR--KDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVV 118
             .|:.|..:|       |.|:...| :||.  .:..||:::|||:..|:|.|  :..:..:.|||
 Frog   119 VMFKWLLAMVASWGWYAGYTVVEWG-DNVHSISEDEAVMLVNHQATGDVCTL--MMCLQDKGTVV 180

  Fly   119 SKKEVLYI-------PFFGIGAWLWGTLYIDRSRK-TDSINSLQKE--AKAIQERNCK-LLLFPE 172
              ::::::       ..|||.:.:.|..:|.:.:. .|....|.|:  .|..:.|:.| ::||||
 Frog   181 --RQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGKAYRDQQLVLLKDHLEKYYRSRDRKWIILFPE 243

  Fly   173 G---TRNSKDSLLPFKKGSF----HIALQGKSPVQPVVISKYSFMDDEKKTFRPGHALIHILPEV 230
            |   .:..:.|.|..||.|.    |:.|......|  ||........|..|...|:.      ||
 Frog   244 GGFLRKRRETSQLYAKKNSLPHLTHVTLPRLGATQ--VILNTLLAQQENGTPTAGNT------EV 300

  Fly   231 STEKYKREDVQLLID 245
            ...|.|  .:|.:||
 Frog   301 KERKQK--GLQWVID 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 55/208 (26%)
lpgat1XP_017949604.1 LPLAT_LCLAT1-like 128..344 CDD:153252 53/201 (26%)
Acyltransf_C 333..404 CDD:374349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.