DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat2 and agpat2

DIOPT Version :9

Sequence 1:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001123741.1 Gene:agpat2 / 100170486 XenbaseID:XB-GENE-940771 Length:276 Species:Xenopus tropicalis


Alignment Length:253 Identity:85/253 - (33%)
Similarity:128/253 - (50%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CVVALILSATAKAPYQMRMFFIFFGAGLIVFLCVPFMILR--PRDYRNALFPSWCFRQLCRLVGI 74
            |.:.|:|||                      |..|..:|.  .|...|....|...|.|....|:
 Frog    36 CAMCLLLSA----------------------LAAPMCLLTNGGRTVNNMRIISRVVRTLKYFFGV 78

  Fly    75 TMEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYLWPVIGRATVVSKKEVLYIPFFGIGAWLWGTL 139
            ..||:||||.:.|...|:|.||||.:|:..|..:.|  .|...::|||::|....|:..:|.|.:
 Frog    79 RFEVKGLENFQIDGPCVIISNHQSILDMMGLMEILP--DRCVQIAKKELMYAGSVGLITYLGGVI 141

  Fly   140 YIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVI 204
            ||:|.|.:|:.:.:...|:|:...|.|:.::||||||:...|||||||:||:|||.:.|:.|||.
 Frog   142 YINRKRTSDAKSIMAAVAQAMISDNLKVWIYPEGTRNNSGDLLPFKKGAFHLALQAQVPIIPVVY 206

  Fly   205 SKY-SFMDDEKKTFRPGHALIHILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSKE 261
            |.. ||.:.:|..|..|...:.|||::.|......|:..|.:.|...|:..:.:||.:
 Frog   207 SSLTSFYNQKKNLFTGGTVKVEILPKIDTSGLTENDITDLTERCHQTMRQVFFRLSNK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 70/183 (38%)
agpat2NP_001123741.1 LPLAT_AGPAT-like 69..251 CDD:153251 70/183 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623097at2759
OrthoFinder 1 1.000 - - FOG0001236
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.