DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aasdh and CG18155

DIOPT Version :9

Sequence 1:NP_609230.2 Gene:Aasdh / 34175 FlyBaseID:FBgn0027780 Length:1012 Species:Drosophila melanogaster
Sequence 2:NP_996360.2 Gene:CG18155 / 31668 FlyBaseID:FBgn0029945 Length:610 Species:Drosophila melanogaster


Alignment Length:421 Identity:78/421 - (18%)
Similarity:141/421 - (33%) Gaps:134/421 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 FFPTDKMMLSQDLYSQMSTAGVDYLVA-----NKHLTVAPLYFTFLGSILVFKEDCRLYRVKLKS 156
            |.||.:.:.|..:|::...|....:|.     |...:.||       ::|::             
  Fly   173 FLPTAESVSSTSMYAKQLVAIQGVIVTENTFPNDFYSKAP-------AMLIY------------- 217

  Fly   157 ADETVQSKKP-------LPANMCYTISTTGTTGKPKLIHV-PYECIAPNIVGLSQKLNVSMADII 213
            ....|.|.||       :.|.|...|.|.         |: |.:|:.| |:.:: :::.::|.::
  Fly   218 TPNAVNSPKPVLLTHRNIEAQMRCLIGTW---------HLGPTDCMLP-ILSMN-RMHAALAAVL 271

  Fly   214 YLGTPIT----FDPFVVEFFLALQNGATLLTSRHSMRDSPSKVLSALFPDNLATPGITVLQMTPS 274
            .:|..:.    ||.         .|..:.|..    .:||||....||   ||.| |...::...
  Fly   272 SVGGNVVLQQKFDG---------HNAWSALLG----INSPSKQRVTLF---LAMP-IVYKRLIVE 319

  Fly   275 LFRQFGASS--IKDRVLSGSSSLRVLLLGGEPFPSNVELVTWMHPSVLMQKHICNIYGITEISCW 337
            ..:.|...|  ::..|......:|::.......|.:| ...|..   :..::|...||:.|... 
  Fly   320 YEKMFAKDSRMVEYIVNHCRQKIRLMATAFALLPDSV-FYRWRE---ITGQNIYEYYGMMETGL- 379

  Fly   338 SLLHIVQSLQSPVP----------------------LGTPIEEDTVLRIESEDNETSQQGELFLG 380
            .|.|.:...|...|                      ||:|::..|...|.::.:|.........|
  Fly   380 VLGHPLNKRQRDSPHNGPTAVAMANNTAPNDYRPGTLGSPLKGVTARLISNKGDELITCKNELGG 444

  Fly   381 SVKRRCYIPEVDDQANAS--------------------------------------QDDSGICFR 407
            ||... .||..|...:||                                      |:::...|.
  Fly   445 SVDSG-LIPVEDIGGDASLAGTIIGELQIAGSNLVSNTLANNNQEMEHKGTTNNEEQENNQDGFF 508

  Fly   408 ATGDLVTRQQDGTLFYSERSNDVVKRAGNRI 438
            .||| :...::|..::..:|:|:....|.::
  Fly   509 KTGD-ICAYRNGNFYFLSKSSDIFTVGGYKV 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AasdhNP_609230.2 AA-adenyl-dom 46..443 CDD:273779 78/421 (19%)
AFD_class_I <168..522 CDD:302604 63/338 (19%)
PQQ_DH_like <728..1012 CDD:299747
PQQ_2 732..978 CDD:290097
CG18155NP_996360.2 CaiC 53..604 CDD:223395 78/421 (19%)
AFD_class_I 58..607 CDD:302604 78/421 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.