DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and TAF14

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_015196.1 Gene:TAF14 / 855974 SGDID:S000006050 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:45/209 - (21%)
Similarity:84/209 - (40%) Gaps:46/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 KWLVYV-----QGKDLPEPLEKYIKKVRFHLHPSY-RPN-DIVDVHRSPFQLNRHGWGEFPMRIQ 334
            :|.:.:     :||::|..:   ..||.:||||:: .|| ...|   .||::...|||.||:.|.
Yeast    31 QWSIEIVLLDDEGKEIPATI---FDKVIYHLHPTFANPNRTFTD---PPFRIEEQGWGGFPLDIS 89

  Fly   335 LFFQEHLQQKPVQLMHTVVLDKTMCGLHTMG-------AETTVEIWLRAKQAITKQ--KSGKPHP 390
            :|..|...::.:.              |.:.       .|..::|.|. |..:|::  |||....
Yeast    90 VFLLEKAGERKIP--------------HDLNFLQESYEVEHVIQIPLN-KPLLTEELAKSGSTEE 139

  Fly   391 PHEQETAVPAPPLAAPNVLEPSVFAFPGESCKPRTISITQNKEELD-DNLFAGINKIELSDDIEK 454
            .......:...........||       ::.:.:|.|.:..|..:| :.|..|:.|:. .||:..
Yeast   140 TTANTGTIGKRRTTTNTTAEP-------KAKRAKTGSASTVKGSVDLEKLAFGLTKLN-EDDLVG 196

  Fly   455 IEPTVLVSEPLKLN 468
            :...|..::..::|
Yeast   197 VVQMVTDNKTPEMN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 23/86 (27%)
TAF14NP_015196.1 TFG3 2..242 CDD:227366 45/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.