DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and YAF9

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_014292.3 Gene:YAF9 / 855616 SGDID:S000005051 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:103 Identity:35/103 - (33%)
Similarity:56/103 - (54%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 VVGNTSKYIGEDSRENGTGGNALTYKWLVYVQGKDLPEPLEKYIKKVRFHLHPSYRPNDIVDVHR 316
            :.|||:|.:|.....|....:  |:.|.::|:|.. .|.:..:||||.|.||.:| ||.:..:..
Yeast    19 IYGNTAKKMGSVKPPNAPAEH--THLWTIFVRGPQ-NEDISYFIKKVVFKLHDTY-PNPVRSIEA 79

  Fly   317 SPFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVL 354
            .||:|...|||||.:.|:::|.|...:|.:...|.:.|
Yeast    80 PPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 29/80 (36%)
YAF9NP_014292.3 TFG3 1..226 CDD:227366 35/103 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.