DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and GAS41

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_199373.1 Gene:GAS41 / 834599 AraportID:AT5G45600 Length:268 Species:Arabidopsis thaliana


Alignment Length:246 Identity:66/246 - (26%)
Similarity:106/246 - (43%) Gaps:42/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VTDHSKDKK---DQPEQEPPISVKLEDEQPCTSRQAHERQVELNASRLNNKNKFNFVVGNTSKYI 260
            :|:.|..||   ||||...|....|:.:.    .::.|:|.:|....::    ...|.||.:.::
plant     1 MTNSSSSKKQAQDQPETSEPTLKSLKTKM----TKSDEKQKKLKDIEIS----VPIVYGNVAFWL 57

  Fly   261 GEDSRENGTGGNALTYKWLVYVQGKDLPEPLEKYIKKVRFHLHPSYR-PNDIVDVHRSPFQLNRH 324
            |:.:.|      ..::||.|||:|. ..|.:...:|||.|.||.|:. |..:::  ..||:::..
plant    58 GKKASE------YQSHKWAVYVRGA-TNEDISVVVKKVVFQLHSSFNSPTRVIE--EPPFEVSES 113

  Fly   325 GWGEFPMRIQLFFQEHLQQKPVQLMHTVVL---DKTMCGLHTMGAETTVEIWLRAKQAITKQKSG 386
            |||||.:.:.|.|...:..||:.|.|.:.|   |::  |..||.....||.:         .:..
plant   114 GWGEFEIAMTLHFHSDVCDKPLSLYHHLKLYPEDES--GPLTMKKPVVVESY---------DEIV 167

  Fly   387 KPHPPHEQETAVP-APPLAAPNVLEPSVFAFPGESCKPRTISITQNKEELD 436
            .|.|.......|. .|.|..|.:  ||.:..|.    |..:..|..|:..|
plant   168 FPDPSESFLARVQNHPALTFPRL--PSGYNLPA----PMQVEDTGKKKRGD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 30/85 (35%)
GAS41NP_199373.1 YEATS_TFIID14_like 44..175 CDD:341129 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.