DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and Mllt1

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_071723.1 Gene:Mllt1 / 64144 MGIID:1927238 Length:547 Species:Mus musculus


Alignment Length:297 Identity:61/297 - (20%)
Similarity:114/297 - (38%) Gaps:60/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 TYKWLVYVQGKDLPE--PLEKYIKKVRFHLHPSY-RPNDIVDVHRSPFQLNRHGWGEFPMRIQLF 336
            |:.|:|:|:|   ||  .::.:::||.|.||.|: :|..:  ....|:::...|:..|.|.|:::
Mouse    29 THDWMVFVRG---PEQCDIQHFVEKVIFRLHDSFPKPKRV--CKEPPYKVEESGYAGFIMLIEVY 88

  Fly   337 FQEHLQQKPVQLMHTVVL--------DKTMCGLHTMGAETTVEIWLRAKQAIT---------KQK 384
            |:...:.:.|...:.:.|        :...|...|....||.   .|.|..:.         ...
Mouse    89 FKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTE---FRCKLLMAGGVMVMPEGADT 150

  Fly   385 SGKPHPPHEQETAVPAPPLAAPNVLEPS-----VFAFPGESCKPRTISITQNKEELDDNLFAGIN 444
            ..:|.|.:.....:|....:.|...:||     .....|::.||..::....:....|:.....:
Mouse   151 VSRPSPDYPMLPTIPLSAFSDPKKNKPSHGSKDANKESGKASKPHKVAREHRERPRKDSESRSCS 215

  Fly   445 K------IELSDDIEKI--------------EPTVLVSEPLKLNYSPR--KQPPT-PSSPPRTQL 486
            |      ....|...|:              ||.:.:.|....:.||:  .|||| |.:..:...
Mouse   216 KEPEREPKSAKDAARKLPKEEKAPVPKAAFKEPKMALKETKLESLSPKGVPQPPTLPKASSKRPA 280

  Fly   487 RLNAAQVTASKP----SVVYLPVNGRSPRQESLPERQ 519
            ..::.:::|.||    |.......|.|||..|.|:::
Mouse   281 ATDSPKLSAKKPKKSGSKGTRRAPGTSPRASSFPDKK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 22/92 (24%)
Mllt1NP_071723.1 YEATS 29..109 CDD:308783 22/84 (26%)
AF-4 <152..>335 CDD:310000 33/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.