DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and yeats4

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_001002752.1 Gene:yeats4 / 437025 ZFINID:ZDB-GENE-040718-252 Length:226 Species:Danio rerio


Alignment Length:220 Identity:61/220 - (27%)
Similarity:103/220 - (46%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 VVGNTSKYIGEDSRENGTGGNALTYKWLVYVQGKDLP---EPLEKYIKKVRFHLHPSYRPNDIVD 313
            |.||.::|.|:...::|.     |::|.|||:    |   |.:..|:||::|.||.|| .|.:..
Zfish    26 VFGNVARYFGKKREDDGH-----THQWTVYVK----PYRNEDMSAYVKKIQFKLHESY-GNPLRV 80

  Fly   314 VHRSPFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVL---DKTMCGLHTMGAETTVEIWLR 375
            |.:.|:::...|||||.:.|::||.:. .::||.|.|.:.|   |.:.....|:.:|...|:..:
Zfish    81 VTKPPYEITETGWGEFEIIIKIFFIDP-NERPVTLYHLLKLFQSDSSAMPKKTVVSEFYDEMIFQ 144

  Fly   376 AKQAITKQKSGKPHP----PHEQETAVPAPPLAAPNVLEPSVFAFPGESCKPRT-ISITQNKEEL 435
            ...|:.:|.......    .::.||......|.....|         ||.|.:| :.||:.||.|
Zfish   145 DPTAMMQQLLNTTRQLTLGAYKHETEFAELELRTREKL---------ESAKKKTSLEITELKERL 200

  Fly   436 -----DDNLFAG-INKIELSDDIEK 454
                 :.|...| |.::|..|.:::
Zfish   201 KASRENINFLKGEIRRLEEDDQMKE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 32/87 (37%)
yeats4NP_001002752.1 YEATS 44..123 CDD:281374 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.