DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and Gas41

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster


Alignment Length:124 Identity:39/124 - (31%)
Similarity:67/124 - (54%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 VVGNTSKYIGEDSRENGTGGNALTYKWLVYVQGKDLP---EPLEKYIKKVRFHLHPSY-RPNDIV 312
            |.||.::..|:...|:|.     |::|.||::    |   |.:..|:|||.|.||.|| .||.| 
  Fly    22 VYGNIARSFGKKREEDGH-----THQWKVYLK----PYFNEDMSIYVKKVHFKLHESYANPNRI- 76

  Fly   313 DVHRSPFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVLDKTMCGLHTMGAETTVE 371
             |.:.|:::...|||||.:.|:::|.:. .::||...|.:.|.::......:.:.||::
  Fly    77 -VVKPPYEITETGWGEFEVIIKIYFNDQ-SERPVTCYHILKLFQSPVVDGELSSSTTMD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 31/85 (36%)
Gas41NP_609086.1 YEATS 40..119 CDD:281374 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.