DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and CG2652

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster


Alignment Length:297 Identity:55/297 - (18%)
Similarity:98/297 - (32%) Gaps:97/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 IKEQGIVTDHSKDKKDQPEQEPPISVKLEDEQPCTSRQAHERQVELNASRLNNKNKFNFVVGNTS 257
            ::.|.:|.|   .::....:.|||:|        |.|....|.:               |:|...
  Fly     7 LRHQNVVDD---CQRVSCNRTPPITV--------TGRCVISRDI---------------VIGCRM 45

  Fly   258 KYIGEDSRENGTGGNALTY----KWLVYVQ-GKDLPEPLEKYIKKVRFHLHPSYRPNDIVDVHRS 317
            :....|          :.|    .|.||:: |:|..: |.:::::|.|.:.|.. |..:.....:
  Fly    46 EQCDPD----------MPYMLEPTWGVYLRPGRDGGD-LSRFVRRVTFKMSPRL-PLRLHVADSA 98

  Fly   318 PFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVLDKTMCGLHTMGAETTVEIWLRAKQAITK 382
            ||::......:||:.:|:.:.:........:....|:.:...|:              .::.:.|
  Fly    99 PFEIGEVLGSDFPVEVQVQYMDARMSATSYIFRPRVVREGHAGI--------------CEEMLDK 149

  Fly   383 QKSGKPHPPHEQETAVPAPPLAAPNVLEPSVFAFPG---------ESCKPRTISITQNKEELDDN 438
            .....|.|...|...         .||.||....||         ||..|.|..  :.||:    
  Fly   150 MIFVNPSPMMRQNLT---------PVLVPSANGAPGDRTSPQFAMESAMPETPG--ERKEQ---- 199

  Fly   439 LFAGINKIELSDDIEKIEPTVLVSEPLKLNYSPRKQP 475
                      ..|.|::......|:|      |.|||
  Fly   200 ----------DRDREQVGDVARPSQP------PAKQP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 17/86 (20%)
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.