DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D12 and gfl-1

DIOPT Version :9

Sequence 1:NP_609228.2 Gene:D12 / 34172 FlyBaseID:FBgn0027490 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_502172.1 Gene:gfl-1 / 187434 WormBaseID:WBGene00001585 Length:211 Species:Caenorhabditis elegans


Alignment Length:243 Identity:60/243 - (24%)
Similarity:104/243 - (42%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 RLNNKNKFN-FVVGNTSKYIG--EDSRENGTGGNALTYKWLVYVQGKDLPEPLEKYIKKVRFHLH 303
            |:..||... .|.|||:...|  .||.::       |::|.|:::...:.:| .|:|:||:|.||
 Worm     7 RMKKKNIVKPIVYGNTATPFGYKRDSDQH-------THQWTVFLKPYLIEDP-TKWIRKVQFKLH 63

  Fly   304 PSYR-PNDIVDVHRSPFQLNRHGWGEFPMRIQLFFQEHLQQKPVQLMHTVVLDKTMCGLHTMGAE 367
            .||. |..:|:  :.|:::...|||||.::|:::|.:. .:||:...|                 
 Worm    64 ESYAVPYRVVE--KPPYEVTETGWGEFEIQIRIYFVDP-NEKPITAFH----------------- 108

  Fly   368 TTVEIWLRAKQAITKQKSGKPHPPHE-------QETAVPA-PPLAAPNVLEPSVFAFPG--ESCK 422
                 :||..|...:..||......|       ||..|.. ..|.|.:...|...||..  |..|
 Worm   109 -----YLRLFQPTIELPSGNQIVCMEFYDEIIFQEPTVQMYKALQASDGKRPDKQAFLNDIEQVK 168

  Fly   423 PRTISITQNKEELDDNLFAGINKIELSDDIEKIEPTVLVSEPLKLNYS 470
            .||       .||.:     :.:.|::.:||.:..::..:..:.:.|:
 Worm   169 TRT-------RELGE-----VAQKEIAAEIEDLRESLKDAHKMIVKYN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D12NP_609228.2 YEATS 275..357 CDD:281374 26/82 (32%)
gfl-1NP_502172.1 YEATS 36..115 CDD:281374 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.