DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment grk and nrg1

DIOPT Version :9

Sequence 1:	NP_476568.2	Gene:	grk / 34171	FlyBaseID:	FBgn0001137	Length:	295	Species:	Drosophila melanogaster
Sequence 2:	NP_001264015.1	Gene:	nrg1 / 796461	ZFINID:	ZDB-GENE-050302-113	Length:	730	Species:	Danio rerio

Alignment Length:	133	Identity:	32/133 - (24%)
Similarity:	59/133 - (44%)	Gaps:	23/133 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   162 STPDSTTPSPNDKETEIQMLPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCA-- 224
            :|..|||||   .:|...:.||:|: ...:|:|.|.||...:....:...|.|.|::.|:||.
Zfish   257 NTATSTTPS---AKTSSHVTPCNES-EKEYCVNHGKCFTLEVTPGNIRRLCRCPNEFTGDRCQHY 317

  Fly   225 -----YKSWNGDYIYSPPTAQRKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQL 284
                 ||....:::.:....|::|            |.::.:.:....|.::..|...:.|:|:.
Zfish   318 VMASFYKHLGIEFMEAEELYQKRV------------LTITGICIALLVVGIMCVVAYCKTKKQRK 370

  Fly   285 HLH 287
            .||
Zfish   371 KLH 373

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
grk	NP_476568.2	None
nrg1	NP_001264015.1	I-set	166..255	CDD:254352
		Ig	178..253	CDD:299845
		PHA03099	257..372	CDD:165381	30/130 (23%)
		Neuregulin	333..718	CDD:280343	9/53 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910