DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grk and Nrg1

DIOPT Version :9

Sequence 1:NP_476568.2 Gene:grk / 34171 FlyBaseID:FBgn0001137 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_006509122.1 Gene:Nrg1 / 211323 MGIID:96083 Length:884 Species:Mus musculus


Alignment Length:181 Identity:45/181 - (24%)
Similarity:76/181 - (41%) Gaps:25/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NRLELQRKQLEASAQEE--ADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIILGSSTD--TWL 128
            |.|..:.|......|::  ..:|..:.....|||..:......:..|.....|.:..|.|  |.:
Mouse   288 NELNRRNKPQNVKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNDLTTGM 352

  Fly   129 ASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYNTSFCL 193
            ::.:..|...||:.......|....     :||||..|||.:.:       ::.|:|...| ||:
Mouse   353 SASTERPYVSSESPIRISVSTEGAN-----TSSSTSTSTTGTSH-------LIKCAEKEKT-FCV 404

  Fly   194 NGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSP--PTAQRK 242
            |||.||....::|...:.|.|.|::.|:||.      :|:.:.  .|::||
Mouse   405 NGGECFMVKDLSNPSRYLCKCPNEFTGDRCQ------NYVMASFYMTSRRK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grkNP_476568.2 None
Nrg1XP_006509122.1 Ig_Pro_neuregulin-1 266..340 CDD:143303 9/51 (18%)
EGF 403..433 CDD:333761 11/29 (38%)
Neuregulin 511..866 CDD:366946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.