DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grk and NRG3

DIOPT Version :9

Sequence 1:NP_476568.2 Gene:grk / 34171 FlyBaseID:FBgn0001137 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_016871062.1 Gene:NRG3 / 10718 HGNCID:7999 Length:747 Species:Homo sapiens


Alignment Length:200 Identity:54/200 - (27%)
Similarity:76/200 - (38%) Gaps:47/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LGSSTDTWL------ASESSTPITDSETVTTPETVTHTGEPPPD---------------PSSSST 163
            |..||.:|.      |:.||:..:.|.|.|||||.|.....|.|               ......
Human   235 LHDSTPSWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFRPRDRRHAIHGNMGKTRVVRRQKQE 299

  Fly   164 PDSTTPSPNDKETEIQMLPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSW 228
            .|:||.|....|   ...||.:. :.::|||.|.||....:..:..| |.|...|.|.||.....
Human   300 QDTTTYSTERSE---HFKPCRDK-DLAYCLNDGECFVIETLTGSHKH-CRCKEGYQGVRCDQFLP 359

  Fly   229 NGDYIYSPPT-------------AQRKV-RMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRR 279
            ..|.|.|.||             .||:| .::.|:|...::.|       |.|.|..::....::
Human   360 KTDSILSDPTDHLGIEFMESEEVYQRQVLSISCIIFGIVIVGM-------FCAAFYFKSKKQAKQ 417

  Fly   280 KQQQL 284
            .|:||
Human   418 IQEQL 422



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JV6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.