DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grk and nrg3b

DIOPT Version :9

Sequence 1:NP_476568.2 Gene:grk / 34171 FlyBaseID:FBgn0001137 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_005156311.1 Gene:nrg3b / 101882495 ZFINID:ZDB-GENE-130603-38 Length:764 Species:Danio rerio


Alignment Length:244 Identity:60/244 - (24%)
Similarity:90/244 - (36%) Gaps:52/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 TDPNPDSGGQLPNADDSIAADPEQDGIILGSSTDTWLASES--------STPITDSETVTTPETV 148
            |:|.|..|.::.....:: ..|..:|   ||.:    ||.|        :|..|.:.|:||..|.
Zfish   188 TNPAPPGGKEVTPRSTTV-RKPNGEG---GSRS----ASPSARAGPPSPTTTSTTTTTITTSTTT 244

  Fly   149 THTGEPPPDPSSSSTPDS------TTPSPNDKETEIQ-----------------MLPCSEAYNTS 190
            |...:|...|:|.|.|..      ::..|:.|.|...                 ..||.::...:
Zfish   245 TQAAQPTSTPASPSKPGQRWNHGRSSKGPSTKPTRPHHRFRTLAPTTSTVRSEFFKPCQDSQEMA 309

  Fly   191 FCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQR---------KVRMA 246
            ||||.|.||....|.. |...|.|...|.|.||.......|.|.|.|||..         :....
Zfish   310 FCLNEGECFIIETVAG-VHRHCRCKEGYRGLRCDQFVPKTDSILSDPTADELGIEFMESAETYQR 373

  Fly   247 HIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC 295
            .|:..|.:.:.:|.|.|...|::....   .:|::.:.||.:.|....|
Zfish   374 QILSIFSIAMGISLLGVACMALYCKNK---RQREKHRAHLTEIRNLRDC 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grkNP_476568.2 None
nrg3bXP_005156311.1 Neuregulin 369..>410 CDD:280343 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JV6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.