DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and DOK2

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_003965.2 Gene:DOK2 / 9046 HGNCID:2991 Length:412 Species:Homo sapiens


Alignment Length:242 Identity:66/242 - (27%)
Similarity:92/242 - (38%) Gaps:61/242 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HLQPTPGTPIIRSG--YLEL--TPRELIFQSPGCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSG 86
            ||:   |:..:|:|  .|||  .|      .||.:...|..:.|||:|.:...|||||||||:||
Human   165 HLR---GSYTLRAGESALELWGGP------EPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSG 220

  Fly    87 PGIYTFRVHNAEQLYPMFQRYINAVNT---------DAFVQGERERVNSAHS------------- 129
            .|.:.|......:::...:..|:|...         .|.:.....|.:|.:|             
Human   221 EGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTT 285

  Fly   130 -VSVNMGRTEGNNYLEPAPLMSRQLG-NFH---SEPSSTSASYPLQANDSQVDDSPPNLQSPVLI 189
             |.....|.:...|..|...::|.|| ||.   :.|....|. ||.  ||..:..||.       
Human   286 PVPAPRPRGQEGEYAVPFDAVARSLGKNFRGILAVPPQLLAD-PLY--DSIEETLPPR------- 340

  Fly   190 PSAYLDQPLRALQDCCLEGTASDLLSTPPSGNRLTSRRR--TMDLPP 234
            |....|:|         ||.|:..|...|...|..:.||  |.|..|
Human   341 PDHIYDEP---------EGVAALSLYDSPQEPRGEAWRRQATADRDP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 29/86 (34%)
DOK2NP_003965.2 PH_DOK1,2,3 7..114 CDD:270195
PTB_DOK1_DOK2_DOK3 147..246 CDD:269914 31/89 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..296 6/49 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..412 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5513
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.