DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and Dok5

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_084037.3 Gene:Dok5 / 76829 MGIID:1924079 Length:306 Species:Mus musculus


Alignment Length:194 Identity:45/194 - (23%)
Similarity:75/194 - (38%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCITSSSKLNELR-GHENVFRVRV---------AHLQPTPGTPIIRSGYLELTPRELIF---QS 52
            |.|:  .:::|::. |..::....|         .:|.|:|...:.....|::|...:..   |:
Mouse   109 MECV--GTRINDISLGEPDLLATGVEREQSERFNVYLMPSPNLDVHGECALQITYEYICLWDVQN 171

  Fly    53 PGCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLY-----------PMFQR 106
            |..:.|.|.|..|||||.:...|:|||||.|.:|.|::.|:..:.|.:|           ...:|
Mouse   172 PRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHER 236

  Fly   107 YINAVNTDAFVQGERERVNSAHSVSVNMGRTEGNNYLEPAPLMSRQLGNFHSEPSSTSASYPLQ 170
            .:.:|........:.||..|..:|               .||.........:...||...|.||
Mouse   237 LLQSVKNSMLQMKKSERAASLSTV---------------VPLPRSAYWQHITRQHSTGQLYHLQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 30/116 (26%)
Dok5NP_084037.3 PH 8..111 CDD:278594 1/1 (100%)
PH_DOK4_DOK5_DOK6 9..113 CDD:270197 2/5 (40%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 27/101 (27%)
DKFBH motif 263..273 1/9 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831555
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.