DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and dok4

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_697365.2 Gene:dok4 / 568912 ZFINID:ZDB-GENE-041008-91 Length:332 Species:Danio rerio


Alignment Length:239 Identity:60/239 - (25%)
Similarity:83/239 - (34%) Gaps:61/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NVFRVRVAHLQPTPGTPIIRSGYLELTPRELI---FQSPGCEPIVWALQHLRRYGLNNDLFSFEA 79
            |||      |.|.|...|.....:::|...:.   ..:|..:.:.|.|..|||||.:...|:|||
Zfish   140 NVF------LLPCPNLDIYGECMMQITHENIYLWDIHNPRTKLVTWPLCSLRRYGRDATRFTFEA 198

  Fly    80 GRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFVQGERERVNSAHSVSVNMGRT------- 137
            ||.|.||.|:|||:....||:|   ||    |::......|:.:     .|.:.|.:.       
Zfish   199 GRMCDSGEGLYTFQTREGEQIY---QR----VHSSTLAIAEQHK-----RVLMEMEKNSKLLSKG 251

  Fly   138 -EGNNY-LEPAPLMSRQLGNFHSEPSSTSASYPLQANDSQVDDSPPNLQSPVLIPSAYLDQPLRA 200
             ||.:| ..|..::.|.....|...|.....   .||.....|..|                   
Zfish   252 PEGTSYPCTPTAILPRSAFWHHITGSQAGVD---SANGDLYGDPQP------------------- 294

  Fly   201 LQDCCLEGTASDLLS--TPPSGNRLTSRRRTMDLPPLESAPAPA 242
                   |..|||.|  .||..:......|....||......|:
Zfish   295 -------GMDSDLFSKRLPPERHSTLPMGRGCSQPPTHYPSYPS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 34/93 (37%)
dok4XP_697365.2 PH 8..111 CDD:278594
PH_DOK4_DOK5_DOK6 9..113 CDD:270197
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 36/107 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574598
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.