Sequence 1: | NP_001260252.1 | Gene: | CG13398 / 34169 | FlyBaseID: | FBgn0032042 | Length: | 442 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060901.2 | Gene: | DOK5 / 55816 | HGNCID: | 16173 | Length: | 306 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 51/197 - (25%) |
---|---|---|---|
Similarity: | 83/197 - (42%) | Gaps: | 31/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGCITSSSKLNELR-GHENVFRVRV---------AHLQPTPGTPIIRSGYLELTPRELIF---QS 52
Fly 53 PGCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFV 117
Fly 118 QGER-ER-VNSAHSVSVNMGRTEGNNYLEP-APLMSRQLGNFHSEPSSTSASYPLQANDSQVDDS 179
Fly 180 PP 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13398 | NP_001260252.1 | PTB_FRS2 | 15..109 | CDD:269913 | 29/105 (28%) |
DOK5 | NP_060901.2 | PH_DOK4_DOK5_DOK6 | 9..113 | CDD:270197 | 2/5 (40%) |
PTB_DOK4_DOK5_DOK6 | 133..235 | CDD:241318 | 30/108 (28%) | ||
DKFBH motif | 263..273 | 1/9 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165141608 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4047 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |