DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and DOK4

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001317485.1 Gene:DOK4 / 55715 HGNCID:19868 Length:365 Species:Homo sapiens


Alignment Length:266 Identity:65/266 - (24%)
Similarity:96/266 - (36%) Gaps:76/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CITSSSKLNELRGHE----------------NVFRVRVAHLQPTPGTPIIRSGYLELTPRELI-- 49
            |:  .|:||::...|                |||      |.|.|...:.....|::|...:.  
Human   111 CL--GSRLNDISLGEPDLLAPGVQCEQTDRFNVF------LLPCPNLDVYGECKLQITHENIYLW 167

  Fly    50 -FQSPGCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNT 113
             ..:|..:.:.|.|..|||||.:...|:|||||.|.:|.|:|||:....||:|            
Human   168 DIHNPRVKLVSWPLCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIY------------ 220

  Fly   114 DAFVQGERERVNSAHSVSVNMGRTEGNNYLEPAPLMSRQL-----GNFH-SEPSSTSASYPLQAN 172
                    :||   ||.::.:........||    |.:.:     |..| |.|.:.:...|..|.
Human   221 --------QRV---HSATLAIAEQHKRVLLE----MEKNVRLLNKGTEHYSYPCTPTTMLPRSAY 270

  Fly   173 DSQVDDSPPNLQSPVLIPSAYLDQPLRALQDCCLEGTASDLLSTPPSGNRLTSRRRTMDLPPLES 237
            ...:..|     ..:...|:|..:.|......|.|.    |....|.|      :.:.|| .|.|
Human   271 WHHITGS-----QNIAEASSYAGESLPCPTPTCQEA----LWRMRPIG------QGSFDL-ALSS 319

  Fly   238 APAPAP 243
            .||..|
Human   320 EPASVP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 32/112 (29%)
DOK4NP_001317485.1 PH_DOK4_DOK5_DOK6 9..113 CDD:270197 1/3 (33%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 35/130 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141612
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.