DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and Dok5

DIOPT Version :10

Sequence 1:NP_609227.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_006235735.1 Gene:Dok5 / 502694 RGDID:1562846 Length:308 Species:Rattus norvegicus


Alignment Length:79 Identity:27/79 - (34%)
Similarity:43/79 - (54%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HLQPTPGTPIIRSGYLELTPRELI---FQSPGCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSGP 87
            :|.|:|...:.....|::|...:.   .|:|..:.|.|.|..|||||.:...|:|||||.|.:|.
  Rat   142 YLMPSPNLDVHGECALQITYEYICLWDIQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGE 206

  Fly    88 GIYTFRVHNAEQLY 101
            |::.|:..:.|.:|
  Rat   207 GLFIFQTRDGEAIY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_609227.1 PTB_FRS2 15..109 CDD:269913 27/79 (34%)
Dok5XP_006235735.1 PH_DOK4_DOK5_DOK6 9..113 CDD:270197
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 27/79 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.