DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and Dok6

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001178872.1 Gene:Dok6 / 498898 RGDID:1564376 Length:331 Species:Rattus norvegicus


Alignment Length:215 Identity:51/215 - (23%)
Similarity:90/215 - (41%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCITSSSKLNELR-GHENVFRVRV---------AHLQPTPGTPIIRSGYLELTPRELI---FQS 52
            |.|:  .::||::. |..::....|         .:|.|||...|.....:::|...:.   ..:
  Rat   109 MECL--GTRLNDISLGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHN 171

  Fly    53 PGCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFV 117
            ...:.::|.|..|||||.::..|:||:||.|.:|.|::||:....|.:|    :.:::.......
  Rat   172 AKVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIY----QKVHSATLAIAE 232

  Fly   118 QGER---ERVNSAH-----------SVSVNMGR-------TEGNNYLEPAPLMSRQLGNFHSEPS 161
            |.||   |....|.           |.|:::.|       |..|:..|   :.|.|...|.|...
  Rat   233 QHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGE---IYSLQGHGFGSSKM 294

  Fly   162 STSASYPLQANDSQVDDSPP 181
            |.:.::|..|.:...:..||
  Rat   295 SRAQTFPSYAPEQSEEAQPP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 27/105 (26%)
Dok6NP_001178872.1 PH_DOK4_DOK5_DOK6 9..113 CDD:270197 2/5 (40%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 26/105 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335308
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.