DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and Dok4

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001101908.1 Gene:Dok4 / 361364 RGDID:1310084 Length:325 Species:Rattus norvegicus


Alignment Length:243 Identity:61/243 - (25%)
Similarity:93/243 - (38%) Gaps:56/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CITSSSKLNELRGHE----------------NVFRVRVAHLQPTPGTPIIRSGYLELTPRELI-- 49
            |:  .|:||::...|                |||      |.|.|...:.....|::|...:.  
  Rat   111 CL--GSRLNDISLGEPDLLAPGVQCEQTDRFNVF------LLPCPNLDVYGECKLQITHENIYLW 167

  Fly    50 -FQSPGCEPIVWALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNT 113
             ..:|..:.:.|.|..|||||.:...|:|||||.|.:|.|:|||:....||:|   || :::...
  Rat   168 DIHNPRVKLVSWPLCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIY---QR-VHSATL 228

  Fly   114 DAFVQGERERVNSAHSVSVNMGRTEGNNY-LEPAPLMSRQLGNFH-------SEPSSTSASYPLQ 170
            ....|.:|..:....:|.:....||..:| ..|..::.|.....|       :|.||....|...
  Rat   229 AIAEQHKRVLLEMEKNVRLLNKGTEHYSYPCTPTAMLPRSAYWHHITGSQNIAEASSYGEGYGAA 293

  Fly   171 ANDSQVDDSPPNLQSPVLIPSAYLDQPLRALQDCCLEGTASDLLSTPP 218
            ...|:.|          |:....|.:|....:|       |....|||
  Rat   294 QASSETD----------LLNRFILLKPKPRQED-------SSETKTPP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 34/112 (30%)
Dok4NP_001101908.1 PH 8..108 CDD:278594
PH_DOK4_DOK5_DOK6 9..113 CDD:270197 1/3 (33%)
PTB_DOK4_DOK5_DOK6 133..235 CDD:241318 34/111 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335302
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.