DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and Dok3

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_038951545.1 Gene:Dok3 / 306760 RGDID:1311840 Length:481 Species:Rattus norvegicus


Alignment Length:243 Identity:66/243 - (27%)
Similarity:95/243 - (39%) Gaps:62/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFVQGERERV 124
            |..:.||::|.:..:|||||||||.||.|::.|....|..:       ..||  .|.:..:|||:
  Rat   240 WPYRFLRKFGSDKGVFSFEAGRRCDSGEGLFAFSSPRAPDI-------CGAV--AAAIARQRERL 295

  Fly   125 -NSAHSVSVNMGRTEGNNYLEPAPLMSRQLGNFHSEPSSTSASYPLQANDSQVDDSPPNLQSPVL 188
             ..|.|....:.|......|||...:......:...|   |...||      .|..|.:|  |:|
  Rat   296 PELAMSPPCPLPRALSLPSLEPPGELREVAPEYELAP---SRKLPL------TDPGPQSL--PLL 349

  Fly   189 IPSAYLDQPLRALQDCCLEGTASDLLST---PPSGNRLTSRRRTMDLPPLESAP----------- 239
                     |...||    ||||.|.::   ..|.::.|......::..||::|           
  Rat   350 ---------LSPTQD----GTASSLYASVCKQTSKHKATVEHLYENVFMLEASPGLSNGGPEAQE 401

  Fly   240 ----APAPVLSPNDAVHMYANVEALIF-----DLNNERCYENVNRLEL 278
                ..:|:.||     :|.|.|.|.:     |.|.|..|..:..|||
  Rat   402 GPPGGRSPLGSP-----IYHNSEELSWPGSAHDSNLEAQYRRLLELEL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 18/48 (38%)
Dok3XP_038951545.1 PH-like 46..160 CDD:418428
PTB_DOK1_DOK2_DOK3 194..292 CDD:269914 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.790

Return to query results.
Submit another query.