DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and Dok2

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_038949088.1 Gene:Dok2 / 290361 RGDID:1310966 Length:429 Species:Rattus norvegicus


Alignment Length:247 Identity:60/247 - (24%)
Similarity:91/247 - (36%) Gaps:66/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSSSKLNELRGHENVFRVRVAHLQ----PTPGTPIIRSGYLELTPRELIFQSPGCEPIVWALQHL 65
            |.:|:...||| ....|..|:.|:    |.|||.:..                      |..:.|
  Rat   177 TEASERCRLRG-SYTLRTGVSALELWGGPEPGTQLYD----------------------WPYRFL 218

  Fly    66 RRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFVQGERERVNSAHSV 130
            ||:|.:...|||||||||:||.|.:.|......:::...::.| |...:|...|......:...:
  Rat   219 RRFGRDKVTFSFEAGRRCVSGEGSFEFETRQGNEIFQALEKAI-AAQKNATPSGPPTLPATGSMM 282

  Fly   131 SVNMGRTEGNNYLEP----------APLMSRQLGNFHSE---PSSTSASYPLQANDSQVDDSPPN 182
            ...:.|.| :.|..|          .|:...:.|....|   |..| ..:.|:.:...:...||.
  Rat   283 PTALPRPE-SPYSRPHDSLPSPSPGTPVPGIRSGGSEGEYAVPFDT-VVHSLKKSFRGILTGPPP 345

  Fly   183 L----------QSPVL-IPSAYLDQPLRALQDCCLEGTASDLL---STPPSG 220
            |          :.||: :|....|:|         ||.|:..|   |..|||
  Rat   346 LLPDPLYDSIQEDPVVPLPDHIYDEP---------EGVAALSLYERSQKPSG 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 26/97 (27%)
Dok2XP_038949088.1 PH-like 42..134 CDD:418428
PTB_DOK1_DOK2_DOK3 167..265 CDD:269914 32/111 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335304
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.790

Return to query results.
Submit another query.