DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and Dok3

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_038767.1 Gene:Dok3 / 27261 MGIID:1351490 Length:444 Species:Mus musculus


Alignment Length:238 Identity:66/238 - (27%)
Similarity:91/238 - (38%) Gaps:52/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFVQGERERV 124
            |..:.||:||.:..:|||||||||.||.|::.|....|..:..:         ..|.:..:|||:
Mouse   203 WPYRFLRKYGSDKGVFSFEAGRRCDSGEGLFAFSSPRAPDICGV---------VAAAIARQRERL 258

  Fly   125 -NSAHSVSVNMGRTEGNNYLEPAPLMSRQLGNFHSEPSSTSASYPLQANDSQVDDSPPNLQSPVL 188
             ..|.|....:.|......||| |...|::......|  |....||         :.|..||..|
Mouse   259 PELAMSPPCPLPRALSLPSLEP-PGELREVAPGFELP--TPRKLPL---------TDPGPQSLPL 311

  Fly   189 IPSAYLDQPLRAL-QDCCLE-----GTASDL------LSTPPSGNRLTS-RRRTMDLPPLESAPA 240
            :.|...:.|...| ...|.:     |||..|      |...|.   ||: .....:.||...:|.
Mouse   312 LLSPTQEGPASGLYASVCKQTSKHTGTAEHLYENVCMLEASPG---LTNGGPEAQEGPPGGRSPL 373

  Fly   241 PAPVLSPNDAVHMYANVEALIF-----DLNNERCYENVNRLEL 278
            .:|:         |.|.|.|.:     |.|.|..|..:..|||
Mouse   374 GSPI---------YHNTEDLSWPGSAQDSNLEAQYRRLLELEL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 19/48 (40%)
Dok3NP_038767.1 PH_DOK1,2,3 9..123 CDD:270195
PTB_DOK1_DOK2_DOK3 157..255 CDD:269914 20/60 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..299 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..390 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.790

Return to query results.
Submit another query.