DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and DOK1

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001372.1 Gene:DOK1 / 1796 HGNCID:2990 Length:481 Species:Homo sapiens


Alignment Length:382 Identity:92/382 - (24%)
Similarity:130/382 - (34%) Gaps:119/382 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KLNELRGHEN---------------VFRVRVAHLQPTPGTPIIRSGYLELTPRELIFQSPGCEPI 58
            ||:.|...||               |.|...|......|:.::|.....||...:..||...||:
Human   134 KLSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPL 198

  Fly    59 V-WALQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYINAVNTDAFVQGERE 122
            : |....|||||.:..:|||||||||.||||.:||:......::       .||.|....|..:.
Human   199 LSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIF-------QAVETAIHRQKAQG 256

  Fly   123 RVNSAHSVSVNMGRTEGNNYLEPAPLMSRQLGNFHSEPSSTSASYPLQANDSQVDDSPPNLQSPV 187
            :....|.|.    |.:.:                  |........|......::.||||.|.:  
Human   257 KAGQGHDVL----RADSH------------------EGEVAEGKLPSPPGPQELLDSPPALYA-- 297

  Fly   188 LIPSAYLDQPLRALQDCCLEGTASDLLSTPPSGNRLTSRRRTMDLPPLESAPAPAPVLSPNDAVH 252
                    :||.:|:           ::..||.:.|.|       .||:|..|.|     .:.|.
Human   298 --------EPLDSLR-----------IAPCPSQDSLYS-------DPLDSTSAQA-----GEGVQ 331

  Fly   253 MYANVEALIFDLNNERCYENVNR--LELPLL-PRE-PISNQ----EPATPTSLAGSCGVNYIVLD 309
               ..:.|.:||     ||:..:  |:..|. |:| ||.::    .|..|..|            
Human   332 ---RKKPLYWDL-----YEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGL------------ 376

  Fly   310 LDQPRSPVGPAGSSKAINGFGSGLSLISTPAAVTAPVTPEAGTTLDVPPPPMQTQSL 366
            .|.||.|.........:.  ..|..|...||.....|           |||..|:.|
Human   377 YDLPREPKDAWWCQARVK--EEGYELPYNPATDDYAV-----------PPPRSTKPL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 34/109 (31%)
DOK1NP_001372.1 PH-like 6..119 CDD:327399
PTB_DOK1_DOK2_DOK3 151..253 CDD:269914 35/108 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..293 4/40 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..329 9/33 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 404..481 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5513
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.