DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and dok2

DIOPT Version :9

Sequence 1:NP_001260252.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_002932742.2 Gene:dok2 / 100487659 XenbaseID:XB-GENE-982227 Length:416 Species:Xenopus tropicalis


Alignment Length:134 Identity:42/134 - (31%)
Similarity:58/134 - (43%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NELRG--HENVFRVRVAHLQPTPGTPIIRSGY------------LELTPRELIFQSPGCEPIVWA 61
            |||..  .|..|.||:   :||..:  :|.|.            |.|..|:     .|.....|.
 Frog   139 NELYSTTRETGFVVRI---RPTEAS--VRCGLNGIYTLSTENSCLSLRDRQ-----TGSSLYNWP 193

  Fly    62 LQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYIN----AVNTDAFVQGERE 122
            ..:|||:|.:..:|||||||||.||.|.:.|......|::...:..||    .|:.:| ..|.|:
 Frog   194 YPYLRRFGRDKSMFSFEAGRRCTSGEGSFEFETPLGGQIFQAIECAINNKKEQVSEEA-PPGSRK 257

  Fly   123 RVNS 126
            |..|
 Frog   258 RTTS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_001260252.1 PTB_FRS2 15..109 CDD:269913 31/107 (29%)
dok2XP_002932742.2 PH-like 7..115 CDD:388408
PH-like 150..244 CDD:388408 32/103 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5513
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.