DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13398 and dok2

DIOPT Version :10

Sequence 1:NP_609227.1 Gene:CG13398 / 34169 FlyBaseID:FBgn0032042 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_002932742.2 Gene:dok2 / 100487659 XenbaseID:XB-GENE-982227 Length:416 Species:Xenopus tropicalis


Alignment Length:134 Identity:42/134 - (31%)
Similarity:58/134 - (43%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NELRG--HENVFRVRVAHLQPTPGTPIIRSGY------------LELTPRELIFQSPGCEPIVWA 61
            |||..  .|..|.||:   :||..:  :|.|.            |.|..|:     .|.....|.
 Frog   139 NELYSTTRETGFVVRI---RPTEAS--VRCGLNGIYTLSTENSCLSLRDRQ-----TGSSLYNWP 193

  Fly    62 LQHLRRYGLNNDLFSFEAGRRCMSGPGIYTFRVHNAEQLYPMFQRYIN----AVNTDAFVQGERE 122
            ..:|||:|.:..:|||||||||.||.|.:.|......|::...:..||    .|:.:| ..|.|:
 Frog   194 YPYLRRFGRDKSMFSFEAGRRCTSGEGSFEFETPLGGQIFQAIECAINNKKEQVSEEA-PPGSRK 257

  Fly   123 RVNS 126
            |..|
 Frog   258 RTTS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13398NP_609227.1 PTB_FRS2 15..109 CDD:269913 31/107 (29%)
dok2XP_002932742.2 PH-like 7..115 CDD:473070
PH-like 150..244 CDD:473070 32/103 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.