DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Klrb1b

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_085102.4 Gene:Klrb1b / 80782 MGIID:107539 Length:223 Species:Mus musculus


Alignment Length:124 Identity:32/124 - (25%)
Similarity:49/124 - (39%) Gaps:30/124 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPN--NSYWIDISKLVENGGTFVST 184
            ||:.: :..||.|..:.|.|....|..|||:.||..:|.....  ||:||.:|          .|
Mouse   106 FHVSQ-VSNTWKECRIDCDKKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLS----------YT 159

  Fly   185 LTGREPFFVKWK------SNQDTKK------KNQCVYIYAKEMSYDECFEKKSFVCQAD 231
            ||.     :.||      .|.|..|      ...|..|..::::.:.|.....::||.:
Mouse   160 LTD-----MNWKWINGTAFNSDVLKITGVTENGSCAAISGEKVTSEGCSSDNRWICQKE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 30/120 (25%)
Klrb1bNP_085102.4 ITIM motif 6..11
LCK-binding motif 32..35
CLECT_NK_receptors_like 94..212 CDD:153063 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.