DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:dkey-28d5.14

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_073764095.1 Gene:si:dkey-28d5.14 / 799569 ZFINID:ZDB-GENE-060503-730 Length:367 Species:Danio rerio


Alignment Length:113 Identity:29/113 - (25%)
Similarity:48/113 - (42%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RHFHIEKNLMQTWFEAYVTCRKMNGHLA---NIQDEMELDGILALAPNNSYWIDISKLVENGGTF 181
            |.:|. .|..:.|.||...||:....||   |:.|.::|:..:.:..|:..||.:....::...:
Zfish    23 RQYHF-INEEKEWAEAQRYCREKYTDLATVDNMNDMIQLNKSVNVNVNDGVWIGLQGTNDSNWHW 86

  Fly   182 VSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
            .|   |...|||.|.|.|.. ..|.|..:...:.....|....:|:|:
Zfish    87 SS---GDPVFFVNWASGQPA-GSNNCTVMTNGKWFVGSCSNTWTFICK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 27/110 (25%)
si:dkey-28d5.14XP_073764095.1 None

Return to query results.
Submit another query.