DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and COLEC11

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001242914.1 Gene:COLEC11 / 78989 HGNCID:17213 Length:285 Species:Homo sapiens


Alignment Length:105 Identity:28/105 - (26%)
Similarity:46/105 - (43%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EAYVTCRKMNGHLANIQDEME---LDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKW 195
            :|.::|:...|.|:..:||..   :...||.|.....:|.|:.| |..|.||.:.......|.||
Human   179 DAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDL-EKEGAFVYSDHSPMRTFNKW 242

  Fly   196 KSNQ--DTKKKNQCVYIYAKEMSYD-ECFEKKSFVCQADQ 232
            :|.:  :...:..||.:.|.....| .|.....|:|:.|:
Human   243 RSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 26/100 (26%)
COLEC11NP_001242914.1 Collagen 58..111 CDD:189968
CLECT_collectin_like 165..280 CDD:153061 27/101 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.