powered by:
Protein Alignment Acp29AB and Klrg2
DIOPT Version :9
Sequence 1: | NP_523512.2 |
Gene: | Acp29AB / 34162 |
FlyBaseID: | FBgn0015583 |
Length: | 234 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028343.2 |
Gene: | Klrg2 / 74253 |
MGIID: | 1921503 |
Length: | 387 |
Species: | Mus musculus |
Alignment Length: | 36 |
Identity: | 10/36 - (27%) |
Similarity: | 14/36 - (38%) |
Gaps: | 0/36 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 DLSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYW 52
|..|.|.......||||.....|:.:.:..|.:..|
Mouse 291 DWEGSQAFCSAHHATLPLLSHTQDFLRKYRITKGSW 326
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1201127at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.