DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec2g

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_081838.1 Gene:Clec2g / 70809 MGIID:1918059 Length:269 Species:Mus musculus


Alignment Length:120 Identity:24/120 - (20%)
Similarity:41/120 - (34%) Gaps:24/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTF 181
            ||::.|:..: ....|..|...|......||...:|.||:.::....|...||.:.         
Mouse   150 VGNKCFYFSE-YTSNWTFAQTFCMAQEAQLARFDNEKELNFLMRYKANFDSWIGLH--------- 204

  Fly   182 VSTLTGREPFFVKWKSNQDTKKKNQ--------CVYIYAKEMSYDECFEKKSFVC 228
                  ||.....||...:|:..|.        |.|:....:|....:..:.::|
Mouse   205 ------RESSEHPWKWTDNTEYNNMIPIQGVETCAYLSGNGISSSRHYIPRIWIC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 22/116 (19%)
Clec2gNP_081838.1 PHA02642 <20..67 CDD:165024
PHA02642 90..255 CDD:165024 24/120 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.