DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Cd209g

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_006508948.1 Gene:Cd209g / 70192 MGIID:1917442 Length:295 Species:Mus musculus


Alignment Length:234 Identity:42/234 - (17%)
Similarity:81/234 - (34%) Gaps:56/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYLLALWNLWDLS-------GGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETL 64
            |:||.|..|..:|       |..||           |...:::|::.:.:..  |::.|:|.:  
Mouse    98 LFLLMLATLVQVSRIRAYSQGQTQD-----------QQGSSSLDKVAVPREQ--THSGLEQIQ-- 147

  Fly    65 AIIDTMEMRIASSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLM 129
                    :|...|.:|.|.:....:|..               .....|:  ||  .::....:
Mouse   148 --------QIQQQLTQFNASLAGLCRPCP---------------WDWELFQ--GS--CYLFSRTL 185

  Fly   130 QTWFEAYVTCRKMNGHL--ANIQDEMELDGILALAPNNSYWIDISKLVENGG-TFVSTLTGREPF 191
            .:|..:..:|..:..||  .|...|.:......:..|...||.:|.....|. .:|.....:..|
Mouse   186 GSWETSASSCEDLGAHLVIVNSVSEQQFLKYWHIRKNQLTWIGLSDHRSEGSWQWVDDTPLKLSF 250

  Fly   192 FVKWKSNQDTKKKNQ-CVYIYAKEMSYDECFEKKSFVCQ 229
               ||..:...:.:: ||.:...:.:...|.....:||:
Mouse   251 ---WKEGEPNNEGDEDCVVMAEDKWNDSRCTANNFWVCE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 19/111 (17%)
Cd209gXP_006508948.1 CLECT_DC-SIGN_like 167..286 CDD:153060 22/140 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5465
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.