DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec2e

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001171160.2 Gene:Clec2e / 689853 RGDID:1587527 Length:214 Species:Rattus norvegicus


Alignment Length:119 Identity:23/119 - (19%)
Similarity:48/119 - (40%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFV 182
            ||:.|:..:: :..|..:..:|..::.|||......||:.:......:::||.:.:        .
  Rat    95 GSKCFYFSED-VGNWTFSQSSCMALDSHLALFDSLEELNFLKRYKGPSNHWIGLHR--------A 150

  Fly   183 STLTGREPFFVKWKSNQDTKKKN--------QCVYIYAKEMSYDECFEKKSFVC 228
            ||   ..|:.  |..|  ||..|        :|.|:....:.....:.::.::|
  Rat   151 ST---EHPWI--WTDN--TKYNNMVLTRGGGECAYLSESGIRSGRGYTRRKWIC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 21/116 (18%)
Clec2eNP_001171160.2 PHA02642 13..199 CDD:165024 23/119 (19%)

Return to query results.
Submit another query.