DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and CLEC7A

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_922938.1 Gene:CLEC7A / 64581 HGNCID:14558 Length:247 Species:Homo sapiens


Alignment Length:112 Identity:30/112 - (26%)
Similarity:54/112 - (48%) Gaps:18/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 MQTWFEAYVTCRKMNGHLANIQDEMELDGI---LALAPNNSYWIDISK-------LVENGGTFVS 183
            :.:|..:...|.::..:|..|....||..|   ::..|:||:||.:|:       |.|:|.||.|
Human   138 LNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSS 202

  Fly   184 TLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSF-VCQ 229
            .|     |.::..:.|:....| ||:|:. .:.||:.....|: :|:
Human   203 NL-----FQIRTTATQENPSPN-CVWIHV-SVIYDQLCSVPSYSICE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 29/110 (26%)
CLEC7ANP_922938.1 ITAM-like 15..18
Ly49 40..>67 CDD:462461
CLECT_NK_receptors_like 120..243 CDD:153063 30/112 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.