DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:dkey-241l7.6

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001038606.3 Gene:si:dkey-241l7.6 / 567708 ZFINID:ZDB-GENE-041014-235 Length:152 Species:Danio rerio


Alignment Length:125 Identity:29/125 - (23%)
Similarity:48/125 - (38%) Gaps:27/125 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAP-NNSYWI-------DISKL 174
            |||.|......: .|..|...|:.:.|:||::.||.|.|.:|.|.| :...||       |...|
Zfish    34 GSRCFRFFSRSV-NWVTAERNCQSLGGNLASVHDEDENDFLLGLVPVSTRCWIGGHDGEQDGQWL 97

  Fly   175 VENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFE------KKSFVC 228
            ..:|..:         .:..|.|.:.:.....|:.|   ..:.|.|:.      :..::|
Zfish    98 WSDGSVY---------SYTNWCSGEPSSGSEHCLEI---NWTSDHCWNNQGCSTRMGYLC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 26/122 (21%)
si:dkey-241l7.6NP_001038606.3 CLECT 26..145 CDD:214480 28/123 (23%)

Return to query results.
Submit another query.