DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec1b

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_064369.1 Gene:Clec1b / 56760 MGIID:1913287 Length:229 Species:Mus musculus


Alignment Length:169 Identity:36/169 - (21%)
Similarity:60/169 - (35%) Gaps:48/169 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 IASSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVT 138
            |..|.::.|:..|.:..|.....|:|..                 |.:....:||  ||.|:...
Mouse    84 IRQSEIKTKSTFEHKCSPCATKWRYHGD-----------------SCYGFFRRNL--TWEESKQY 129

  Fly   139 CRKMNGHLANIQDEMELDGI---------LALAPNNS----YWIDISKLVENGGTFVSTLTGREP 190
            |.:.|..|.....:..||.|         :.|:..||    .|.|.|.|.:||    ..|:|   
Mouse   130 CTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNG----INLSG--- 187

  Fly   191 FFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQ 229
                     :|::...|.|::..::....|.|:...:|:
Mouse   188 ---------NTEENMNCAYLHNGKIHPASCKERHYLICE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 27/120 (23%)
Clec1bNP_064369.1 CLECT_NK_receptors_like 102..218 CDD:153063 31/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201127at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.