DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and Clec7a

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_064392.2 Gene:Clec7a / 56644 MGIID:1861431 Length:244 Species:Mus musculus


Alignment Length:111 Identity:24/111 - (21%)
Similarity:48/111 - (43%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 TWFEAYVTCRKMNGHLANIQDEMELDGILALAPN---NSYWIDISK-------LVENGGTFVSTL 185
            :|:.:...|.::..||..|.:..|.:.|.:...:   |::||.:|:       ..|:|..|..  
Mouse   139 SWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFP-- 201

  Fly   186 TGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQAD 231
               ..|.|:..:.|::...| ||:|:..|:....|......:|:.:
Mouse   202 ---NSFQVRNTAPQESLLHN-CVWIHGSEVYNQICNTSSYSICEKE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 23/107 (21%)
Clec7aNP_064392.2 ITAM-like 15..18
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..113
CLECT_NK_receptors_like 119..242 CDD:153063 24/108 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.