DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:dkey-28d5.8

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_073764096.1 Gene:si:dkey-28d5.8 / 559335 ZFINID:ZDB-GENE-060503-354 Length:364 Species:Danio rerio


Alignment Length:118 Identity:30/118 - (25%)
Similarity:48/118 - (40%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RHFHIEKNLMQTWFEAYVTCRKMNGHLA---NIQDEMEL-----DGILALAPNNSYWIDISKLVE 176
            |.:|. .|:.:.|.||...|||....||   |:.|.::|     ||:     |...||.:.|   
Zfish    23 RQYHF-INVNKNWTEAQRYCRKKYTDLATVDNMNDMIQLMKSVNDGV-----NQLVWIGLQK--- 78

  Fly   177 NGGTFVSTLTGREP-FFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
             ...:....:..:| .|:.|.|. ::...|||..:...:...:.|.....|:|
Zfish    79 -ANVYKWHWSSGDPVLFLNWTSG-ESAGSNQCTVMCNGQWIKEACNNTSVFIC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 29/117 (25%)
si:dkey-28d5.8XP_073764096.1 None

Return to query results.
Submit another query.