DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:ch211-282j17.11

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001314987.1 Gene:si:ch211-282j17.11 / 557100 ZFINID:ZDB-GENE-041210-284 Length:366 Species:Danio rerio


Alignment Length:116 Identity:32/116 - (27%)
Similarity:51/116 - (43%) Gaps:17/116 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RHFH-IEKNLMQTWFEAYVTCRKMNGHLA---NIQDEMELDGILALAPNNSY-WIDISKLVENGG 179
            |.:| |.:|  :||.||...||:....||   |:.|.::|.  .::..|:.| ||.:.|:.....
Zfish    23 RQYHFINEN--KTWTEAQRYCREKYTDLATVDNMNDMIQLK--KSVKVNDGYAWIGLQKMSVYKW 83

  Fly   180 TFVSTLTGREPFFVKWKSNQDTKKKNQCVYIYAK--EMSYDECFEKKSFVC 228
            .:.|   |....|:.|.|.|..:..|..|....|  ...|.:.:   :|:|
Zfish    84 HWSS---GDPVLFLNWASGQPAEGDNCTVMRNGKWFVAPYSDAW---TFIC 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 31/115 (27%)
si:ch211-282j17.11NP_001314987.1 CLECT_1 23..130 CDD:153072 32/116 (28%)
CLECT_1 135..245 CDD:153072
CLECT 251..363 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.