DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:ch211-282j17.10

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001026840.1 Gene:si:ch211-282j17.10 / 557030 ZFINID:ZDB-GENE-041210-283 Length:368 Species:Danio rerio


Alignment Length:114 Identity:30/114 - (26%)
Similarity:47/114 - (41%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HFHIEKNLMQTWFEAYVTCRKMNGHLA---NIQDEMELDGILALAPNNSYWIDISKLVENGGTFV 182
            ||..||   :...||...||:....||   |:.|.:||...:..|...:.||.:.:      |.|
Zfish    26 HFINEK---KNCTEAQRYCREKYKDLATVDNMNDTIELIKSVNNARVQNIWIGLQR------TSV 81

  Fly   183 ---STLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
               ...:|...||:.|.| ::....|:|..:...:...:.|...:.|||
Zfish    82 YKWHWSSGDPVFFLNWTS-EEPAGNNECTVMNNGQWINEACNNTRVFVC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 30/114 (26%)
si:ch211-282j17.10NP_001026840.1 CLECT 24..131 CDD:470576 30/114 (26%)
CLECT_1 134..247 CDD:153072
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.