DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:ch73-335d12.2

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001076271.1 Gene:si:ch73-335d12.2 / 555932 ZFINID:ZDB-GENE-060503-423 Length:366 Species:Danio rerio


Alignment Length:117 Identity:31/117 - (26%)
Similarity:52/117 - (44%) Gaps:19/117 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RHFH-IEKNLMQTWFEAYVTCRKMNGHLA---NIQDEMELDGILALAPNNSY-WIDISKLVENGG 179
            |.:| |.||  :||.||...||:....||   |:.|.::::  .::..|:.| ||.:.:      
Zfish    23 RQYHFINKN--KTWTEAQRYCREKYTDLATVDNMNDMIQMN--KSVKVNDGYAWIGLQR------ 77

  Fly   180 TFV---STLTGREPFFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
            |.|   ...:|....|:.|.|.|.....| |..:...:...:.|.:..:|:|
Zfish    78 TSVYKWHWSSGDSVLFLNWASGQPAGGDN-CTVMRNGKWFVEPCSDAWTFIC 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 30/116 (26%)
si:ch73-335d12.2NP_001076271.1 CLECT_1 23..130 CDD:153072 31/117 (26%)
CLECT_1 133..245 CDD:153072
CLECT 251..363 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.