DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and si:dkey-88n24.6

DIOPT Version :10

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001314972.1 Gene:si:dkey-88n24.6 / 555551 ZFINID:ZDB-GENE-041014-88 Length:368 Species:Danio rerio


Alignment Length:114 Identity:25/114 - (21%)
Similarity:46/114 - (40%) Gaps:12/114 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RHFH-IEKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGILALAPN---NSYWIDISKLVENGGT 180
            |.:| |.:|  :.|.||...||:....||.:.:..:|..:...|.|   .:.||.:.:.    |.
Zfish    23 RQYHFINEN--KNWTEAQRYCREKYTDLATVDNMNDLIQLKKSANNEGVQNIWIGLQRT----GV 81

  Fly   181 FVSTLTGREP-FFVKWKSNQDTKKKNQCVYIYAKEMSYDECFEKKSFVC 228
            :....:..:| .|:.|.|.:....: :|..:...:.....|.....|:|
Zfish    82 YKWYWSSGDPALFLNWASGEPAGSE-ECAVMRNGQWIVWLCSNVSFFIC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 24/113 (21%)
si:dkey-88n24.6NP_001314972.1 CLECT_1 23..129 CDD:153072 24/112 (21%)
CLECT_1 136..247 CDD:153072
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.