DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and lectin-29Ca

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster


Alignment Length:233 Identity:105/233 - (45%)
Similarity:143/233 - (61%) Gaps:0/233 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YASNLLYLLALWNLWDLSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAI 66
            ||:.:..:.||||.|.:|..:||...|...||....|..||:.|.::|.:|||||:|:||.||..
  Fly     4 YATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAPMPYYTIENIDMHQQHWFTYNSLRQNGTLWR 68

  Fly    67 IDTMEMRIASSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQT 131
            |..||.|:...|..|:.|||.:|:.||..:..:..|:|.||.|||..|:|:|||||::||.....
  Fly    69 IGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMP 133

  Fly   132 WFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWK 196
            |..||.|||:|.||||||.||.||:.|.:......||:||:....:|.:::|||:||:..|:|||
  Fly   134 WDSAYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWK 198

  Fly   197 SNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQADQWA 234
            .|..|...|.||||.:.||.::.|.....|.|||:|||
  Fly   199 PNLATNIHNHCVYINSNEMYFENCANDNYFACQAEQWA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 47/107 (44%)
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448750
Domainoid 1 1.000 50 1.000 Domainoid score I11571
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.800

Return to query results.
Submit another query.