DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and lectin-24A

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:303 Identity:73/303 - (24%)
Similarity:117/303 - (38%) Gaps:98/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYASNLLYLLALWNLWDLSGGQ-----QDIP---NGKATLPSPQTPQNTIDQIGINQNYWFTYNA 57
            |:..::|.|..|....:.|.|.     |.:|   ||.. .|   |.:..::.:.|:|:.|.|...
  Fly     1 MFRLSVLVLNLLLVSHEFSAGTAKIEIQPLPALCNGYC-FP---TLKPVMEYVAIHQDKWNTCTE 61

  Fly    58 LKQNETLAIIDTMEMRIASSLLEFKAQMEIQLQPLKIIMRHHASNIKASN--------------- 107
            :..||.               .:.:.|:.|||..||.    ..||||||.               
  Fly    62 ILANEA---------------RKDQIQLNIQLDALKA----DVSNIKASQLSKDEKLDRMEREQF 107

  Fly   108 -------------NIKMRR-----------------------------------FEKVGSRHFHI 124
                         .:|:.|                                   |||:|.|:|:|
  Fly   108 AMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYI 172

  Fly   125 EKNLMQTWFEAYVTCRKMNGHLANIQDEMELDGIL-ALAPNNSYWIDISKLVENGGTFVSTLTGR 188
            |:::...|.:|...||:|.||||:|:.:.|.|.|: .|..:.||::.:::..:. |.|||..:|:
  Fly   173 EEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKT-GDFVSAASGK 236

  Fly   189 EPFFVKWKSNQDTKKKNQ--CVYIYAKEMSYDECFEKKSFVCQ 229
            ...:.:|...:.....:|  ||.|..|.|....|..:|.|:||
  Fly   237 SCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 34/110 (31%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
76.800

Return to query results.
Submit another query.