DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acp29AB and lectin-30A

DIOPT Version :9

Sequence 1:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:220 Identity:82/220 - (37%)
Similarity:124/220 - (56%) Gaps:12/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAIIDTMEMRIASSLLEFK 82
            |:...:|:...|...|.      .|||:.|||..|||:.|||::|....|..:|..|...|:..:
  Fly    11 LAWASRDVLANKTENPL------LIDQVAINQQQWFTFIALKESEMQQKIVRIERSIEERLMAMQ 69

  Fly    83 AQMEIQLQPLKIIMRHHA----SNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMN 143
            :::...|..|:.||.:.:    ..::.|:.|....|:::|:|.|:|||...|.||.|..|||::.
  Fly    70 SKLAYALNELQTIMGNQSVETLEKLRISHRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQLG 134

  Fly   144 GHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQCV 208
            ||:|.|:||.|.:.|.:.||...:|||::.:.:| |.|.|:||||.|.|.||| .::...|..||
  Fly   135 GHIATIRDEQEFNEIFSRAPAGVFWIDMNAMFKN-GLFASSLTGRSPPFFKWK-KEERGNKFDCV 197

  Fly   209 YIYAKEMSYDECFEKKSFVCQADQW 233
            .:|.|||..:.||....|:|||:||
  Fly   198 NVYNKEMYNENCFNTHLFICQAEQW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 47/107 (44%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 43/101 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448751
Domainoid 1 1.000 50 1.000 Domainoid score I11571
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22803
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
98.900

Return to query results.
Submit another query.